PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 270aa    MW: 30835.2 Da    PI: 5.1982
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42741.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.41.2e-16187245462
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le+eN++L ke+ee +ke ++  +e
  KFK42741.1 187 AQRQKRMIKNRESAARSRERKQAYQVELETMAAKLEQENEELLKEIEEKTKERYEKLME 245
                 79*********************************************998888776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000417.1E-5729IPR001630cAMP response element binding (CREB) protein
PRINTSPR000417.1E-5183199IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1701.9E-13183238No hitNo description
SMARTSM003381.6E-12184249IPR004827Basic-leucine zipper domain
PfamPF001702.2E-15186245IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.277186238IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.0E-10188239No hitNo description
CDDcd147077.85E-14188221No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
PRINTSPR000417.1E-5201221IPR001630cAMP response element binding (CREB) protein
PRINTSPR000417.1E-5221238IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MASFKMMSSS NSRNSDLSRR NSSSASSSPS IRPHNLRLDP HSHHSRINFS DGDDYNFASD  60
LKPVIDFDRS NGDRNSDNGG GRKRSVDDVW KEIISGEKKT IMKEETQEEE NIMTLEDFLA  120
KADYDDDDDA NRDSDEIDVK IPITQDGGSG SGSYTFDYPM MQGSVSGGIR GKRGRVMMIE  180
AMDKVAAQRQ KRMIKNRESA ARSRERKQAY QVELETMAAK LEQENEELLK EIEEKTKERY  240
EKLMEKLIPV DEKPKQPLSR SLSRSYSLEW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_171893.11e-105G-box binding factor 4
SwissprotP427771e-107GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A087HKT90.0A0A087HKT9_ARAAL; Uncharacterized protein
STRINGAT1G03970.11e-104(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.12e-61G-box binding factor 4